PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09503A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 253aa    MW: 27490 Da    PI: 7.0217
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09503AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.72.5e-35231221100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +Ca+C+++rr+C ++Cvlapyfpa++ ++f++vh++FGasnv+kll++l++e+r +a++slvy+A+ r+ +P  G+v+ i+ lq
  Oropetium_20150105_09503A  23 PCAGCRHQRRRCLSSCVLAPYFPAQDGARFNAVHRVFGASNVSKLLAELRPEDRAEAAESLVYQANERIWEPTMGCVSYISILQ 106
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                + +++++ e+a+++e 
  Oropetium_20150105_09503A 107 NVIQHVEGEVAAAREA 122
                                *********9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.94322123IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3423120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSSSLGEEEE PMTPAAVTTS LTPCAGCRHQ RRRCLSSCVL APYFPAQDGA RFNAVHRVFG  60
ASNVSKLLAE LRPEDRAEAA ESLVYQANER IWEPTMGCVS YISILQNVIQ HVEGEVAAAR  120
EALAGLVGRE AAFRPFDASA ATFEARQEAE VRLARALRFA EEKYGEIRTM ILQRQAAEAA  180
EEKDQMAAAA AQTARRDQTQ MMPQAAAAPK RRKHAVAQHS GVGRGFSDGQ PRQPMMQRME  240
AQESGSSAVA AQA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.23e-34LOB domain-containing protein 10